Human TNFRSF4 protein
This Human TNFRSF4 protein spans the amino acid sequence from region 29-216aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; TNFRSF4; OX40; CD134; Txgp1
UniProt
P43489
Expression Region
29-216aa
Tag
C-terminal Fc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
1Loaded Biotinylated Human OX40L-His on AR2G Biosensor, can bind Human OX40-Fc with an affinity constant of 70.3 nM as determined in BLI assay. 2Loaded Cynomolgus OX40L-His on HIS1K Biosensor, can bind Human OX40-Fc with an affinity constant of 165nM as determined in BLI assay.
Form
Lyophilized powder
Molecular Weight
46.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
AA Sequence
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6231753-01 0.1 mL
BAZ2B (Bromodomain Adjacent to Zinc Finger Domain Protein 2B, hWALp4, KIAA1476, DKFZp434H071, DKFZp762I0516, FLJ45644, hWALp4, WALp4) (MaxLight 750)
Sign In for Pricing
View Details MBS6231753-02 5x 0.1 mL
BAZ2B (Bromodomain Adjacent to Zinc Finger Domain Protein 2B, hWALp4, KIAA1476, DKFZp434H071, DKFZp762I0516, FLJ45644, hWALp4, WALp4) (MaxLight 750)
Sign In for Pricing
View Details 
GTR15286283 1 Vial
Lentiviral mouse Olfml1 shRNA (UAS) - Lentiviral mouse Olfml1 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details GTR15279950 1 Vial
Lentiviral mouse Rab8b shRNA (UAS) - Lentiviral mouse Rab8b shRNA (UAS, iRFP) (25)
Sign In for Pricing
View Details