Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF4 protein

This Human TNFRSF4 protein spans the amino acid sequence from region 29-216aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor superfamily member 4; TNFRSF4; OX40; CD134; Txgp1

UniProt

P43489

Expression Region

29-216aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse OX40L-His at 10μg/ml can bind Human OX40-6His (Biotinylated by NHS-biotin prior to testing), the ED50 of Recombinant Human OX40-6His is 1.44 ug/ml.

Form

Lyophilized powder

Molecular Weight

21 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DEP-1/CD148 Antibody (261922) [PE/Cy5.5]
FAB19341PECY55 0.1 mL

Mouse Monoclonal DEP-1/CD148 Antibody (261922) [PE/Cy5.5]

Sign In for Pricing
View Details
CXCR5 (NM_001716) Human Tagged Lenti ORF Clone
RC213050L4 10 µg

CXCR5 (NM_001716) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Enkephalin Sequence, 3,5-Diiodo-D-Tyr-Ala-Gly-Gly
E3220-20J 1 mg

Enkephalin Sequence, 3,5-Diiodo-D-Tyr-Ala-Gly-Gly

Sign In for Pricing
View Details
Epithelial Marker Antigen Antibody / MUC1 / Mucin-1
orb2638110 7 mL

Epithelial Marker Antigen Antibody / MUC1 / Mucin-1

Sign In for Pricing
View Details
EDA (NM_001005610) Human Tagged ORF Clone
RG215628 10 µg

EDA (NM_001005610) Human Tagged ORF Clone

Sign In for Pricing
View Details
Thymalfasin Impurity Des-Asp15
RM-T251926-01 10 mg

Thymalfasin Impurity Des-Asp15

Sign In for Pricing
View Details