Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD47 protein

This Human CD47 protein spans the amino acid sequence from region 19-139aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6

UniProt

Q08722

Expression Region

19-139aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Loaded Anti-Human CD47 mAb-Fc on Protein A Biosensor, can bind Human CD47-His with an affinity constant of 0.22 nM as determined in BLI assay.

Form

Lyophilized powder

Molecular Weight

14.76 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0

AA Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain 14 (CAPN14) (NM_001145122) Human Tagged ORF Clone
RG226657 10 µg

Calpain 14 (CAPN14) (NM_001145122) Human Tagged ORF Clone

Sign In for Pricing
View Details
Chicken RNA Binding Motif Protein 38 ELISA Kit
MBS086497 Inquire

Chicken RNA Binding Motif Protein 38 ELISA Kit

Sign In for Pricing
View Details
4- (1-Ethylpropyl) benzaldehyde
OR1082275-01 250 mg

4- (1-Ethylpropyl) benzaldehyde

Sign In for Pricing
View Details
4- (1-Ethylpropyl) benzaldehyde
OR1082275-02 500 mg

4- (1-Ethylpropyl) benzaldehyde

Sign In for Pricing
View Details
4- (1-Ethylpropyl) benzaldehyde
OR1082275-03 1 g

4- (1-Ethylpropyl) benzaldehyde

Sign In for Pricing
View Details
4- (1-Ethylpropyl) benzaldehyde
OR1082275-04 5 g

4- (1-Ethylpropyl) benzaldehyde

Sign In for Pricing
View Details