Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD47 protein

This Human CD47 protein spans the amino acid sequence from region 19-139aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6

UniProt

Q08722

Expression Region

19-139aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Loaded Anti-Human CD47 mAb-Fc on Protein A Biosensor, can bind Human CD47-His with an affinity constant of 0.22 nM as determined in BLI assay.

Form

Lyophilized powder

Molecular Weight

14.76 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0

AA Sequence

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXPH3 Antibody
E38PA5014 100 µL

NXPH3 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal EMMPRIN/CD147 Antibody
NBP2-34025 0.1 mL

Rabbit Polyclonal EMMPRIN/CD147 Antibody

Sign In for Pricing
View Details
Bcl10 (4I12) Rabbit Monoclonal Antibody
E28M5825 100 µL

Bcl10 (4I12) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Chicken TRAF2 and NCK-Interacting Protein Kinase (TNIK) ELISA Kit
MBS9906281 Inquire

Chicken TRAF2 and NCK-Interacting Protein Kinase (TNIK) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat TUBB4B Protein, His (Fc)-Avi-tagged
TUBB4B-6020R 50 µg

Recombinant Rat TUBB4B Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Tusc2 AAV siRNA Pooled Vector
48846166 1.0 µg

Tusc2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details