Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD86 protein

This Human CD86 protein spans the amino acid sequence from region 24-247aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-Lymphocyte Activation Antigen CD86; Activation B7-2 Antigen; B70; BU63; CTLA-4 Counter-Receptor B7.2; FUN-1; CD86; CD28LG2

Expression Region

24-247aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CTLA-4-Fc-Avi at 5μg/ml can bind Human B7-2-His, the ED50 of Recombinant Human B7-2-His is 1.19 μg/ml.

Form

Lyophilized powder

Molecular Weight

26.69 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

AA Sequence

APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMC1 Rabbit Polyclonal Antibody
orb154839 100 µg

ARMC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Zebrafish N-Cadherin/CDH2 Antibody Picoband® Fluoro550 Conjugated
AZQ90275-Fluoro550 100 µg/Vial

Anti-Zebrafish N-Cadherin/CDH2 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Recombinant Human AHNAK2
MBS7615856-01 0.05 mg

Recombinant Human AHNAK2

Sign In for Pricing
View Details
Recombinant Human AHNAK2
MBS7615856-02 0.2 mg

Recombinant Human AHNAK2

Sign In for Pricing
View Details
Recombinant Human AHNAK2
MBS7615856-03 1 mg

Recombinant Human AHNAK2

Sign In for Pricing
View Details
Recombinant Human AHNAK2
MBS7615856-04 5x 1 mg

Recombinant Human AHNAK2

Sign In for Pricing
View Details