Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF9 protein

This Human TNFRSF9 protein spans the amino acid sequence from region 24-186aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA

UniProt

Q07011

Expression Region

24-186aa

Tag

C-terminal Fc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human 4-1BBL-His at 10μg/ml can bind Human 4-1BB-Fc, the ED50 of Human 4-1BB-Fc is 16.8 ng/ml.

Form

Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 Antibody / CLIP
V5829-20UG 20 µg

CD74 Antibody / CLIP

Sign In for Pricing
View Details
General Prostaglandin E2 (PGE2) ELISA Kit
EK20356 48 Tests

General Prostaglandin E2 (PGE2) ELISA Kit

Sign In for Pricing
View Details
RN5S26 Protein Vector (Human) (pPB-C-His)
PV116626 500 ng

RN5S26 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
6-[di (methyl-d3) amino]pyridine-2-carboxylic acid
CS-O-42330 1 Each

6-[di (methyl-d3) amino]pyridine-2-carboxylic acid

Sign In for Pricing
View Details
CCL17/TARC Antibody
orb1536871 60 μl

CCL17/TARC Antibody

Sign In for Pricing
View Details
FAM69B (DIPK1B) (NM_152421) Human Tagged Lenti ORF Clone
RC204222L4 10 µg

FAM69B (DIPK1B) (NM_152421) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details