What is the catalog number for Human TNFRSF9 protein?

The catalog number for Human TNFRSF9 protein is orb594868.

What sizes are available for Human TNFRSF9 protein?

Human TNFRSF9 protein is available in the following size(s): 10 µg, 50 µg, 500 µg, 1 mg.

How many pack sizes does Human TNFRSF9 protein come in?

Human TNFRSF9 protein is available in 4 different pack sizes.

Is Human TNFRSF9 protein in stock?

Human TNFRSF9 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human TNFRSF9 protein

This Human TNFRSF9 protein spans the amino acid sequence from region 24-186aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA

UniProt

Q07011

Expression Region

24-186aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Loaded Human 4-1BB-His on HIS1K Biosensor, can bind Anti-Human CD137 mAb-Fc with an affinity constant of 25.5 nM as determined in BLI assay.

Form

Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ