Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCGR3A protein

This Human FCGR3A protein spans the amino acid sequence from region 17-208aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A; CD16a Antigen; Fc-Gamma RIII-Alpha; Fc-Gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc Receptor III-2; CD16a; FCGR3A; CD16A; FCG3; FCGR3; IGFR3

Expression Region

17-208aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Loaded Human IgG1 Fc on Protein-A Biosensor, can bind Human CD16a-His (V176) with an affinity constant of 0.571 uM as determined in BLI assay.

Form

Lyophilized powder

Molecular Weight

22.61 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

AA Sequence

GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TNF RII/TNFRSF1B/CD120b Protein
RP00545 10 µg

Recombinant Mouse TNF RII/TNFRSF1B/CD120b Protein

Sign In for Pricing
View Details
Adamts2 siRNA Oligos set (Mouse)
11359174 3x 5 nmol

Adamts2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
TCP10L Antibody
MBS8505716-01 0.1 mg

TCP10L Antibody

Sign In for Pricing
View Details
TCP10L Antibody
MBS8505716-02 0.1 mL (AF405L)

TCP10L Antibody

Sign In for Pricing
View Details
TCP10L Antibody
MBS8505716-03 0.1 mL (AF405S)

TCP10L Antibody

Sign In for Pricing
View Details
TCP10L Antibody
MBS8505716-04 0.1 mL (AF610)

TCP10L Antibody

Sign In for Pricing
View Details