Human FCGR3A protein
This Human FCGR3A protein spans the amino acid sequence from region 17-208aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A; CD16a Antigen; Fc-Gamma RIII-Alpha; Fc-Gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc Receptor III-2; CD16a; FCGR3A; CD16A; FCG3; FCGR3; IGFR3
Expression Region
17-208aa
Tag
C-terminal 6xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Loaded Human IgG1 Fc on Protein-A Biosensor, can bind Human CD16a-His (V176) with an affinity constant of 0.571 uM as determined in BLI assay.
Form
Lyophilized powder
Molecular Weight
22.61 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Extracellular Domain
Preservative
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
AA Sequence
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2390903 1.0 µg DNA
TMEM53 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details K7068003 1.0 µg DNA
Rplp1 sgRNA CRISPR Lentivector (Rat) (Target 2)
Sign In for Pricing
View Details 
042643-FITC 200 µL
TBCA, ID (TBCA, Tubulin-specific chaperone A, TCP1-chaperonin cofactor A, Tubulin-folding cofactor A) (FITC) discontinued
Sign In for Pricing
View Details