Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NECTIN2 protein

This Human NECTIN2 protein spans the amino acid sequence from region 32-360aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Poliovirus Receptor-Related Protein 2; Herpes Virus Entry Mediator B; Herpesvirus Entry Mediator B; HveB; Nectin-2; CD112; PVRL2; HVEB; PRR2

UniProt

Q92692

Expression Region

32-360aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.1Immobilized Human PVRIG-mFc at 10μg/ml can bind Human Nectin-2-His, the ED50 of Human Nectin-2-His is 3.72 ug/ml.2Immobilized Human PVRIG-Fc at 10μg/ml can bind Human Nectin-2-His, the ED50 of Human Nectin-2-His is 2.914 ug/ml.

Form

Lyophilized powder

Molecular Weight

36.58 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

AA Sequence

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD140a (PDGF Receptor) (AP)
MBS6241625-01 0.1 mL

CD140a (PDGF Receptor) (AP)

Sign In for Pricing
View Details
CD140a (PDGF Receptor) (AP)
MBS6241625-02 5x 0.1 mL

CD140a (PDGF Receptor) (AP)

Sign In for Pricing
View Details
Lentiviral mouse Xkr8 shRNA (UAS) - Lentiviral mouse Xkr8 shRNA (UAS, RFP) plasmid
GTR15260401 1 Vial

Lentiviral mouse Xkr8 shRNA (UAS) - Lentiviral mouse Xkr8 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Acetoxyisovalerylshikonin, β- discontinued
371136 5 mg

Acetoxyisovalerylshikonin, β- discontinued

Sign In for Pricing
View Details
Recombinant Human Calmodulin-2
MBS143411-01 0.005 mg

Recombinant Human Calmodulin-2

Sign In for Pricing
View Details
Recombinant Human Calmodulin-2
MBS143411-02 0.025 mg

Recombinant Human Calmodulin-2

Sign In for Pricing
View Details