Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit TNF protein

This Rabbit TNF protein spans the amino acid sequence from region 78-235aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; TNF; TNFA; TNFSF2

UniProt

P04924

Expression Region

78-235aa

Tag

Tag-Free

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 3.5 pg/ml.

Form

Lyophilized powder

Molecular Weight

17.59 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 300 mM NaCl, pH 7.4

AA Sequence

VTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4F2P ORF Vector (Human) (pORF)
ORF026778 1.0 µg DNA

OR4F2P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
14-3-3, sigma (SFN, Stratifin, HGNC:10773) (BSA & Azide Free) (MaxLight 550)
0014-07A-ML550 100 µL

14-3-3, sigma (SFN, Stratifin, HGNC:10773) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
Tmem184b 3'UTR Luciferase Stable Cell Line
TU222074 1.0 mL

Tmem184b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
WDR35 Rabbit pAb, PE-Cy7 conjugated
orb2852737 100 µL

WDR35 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
NDUFB1 Conjugated Antibody
MBS9445575-01 0.1 mL (Biotin)

NDUFB1 Conjugated Antibody

Sign In for Pricing
View Details
NDUFB1 Conjugated Antibody
MBS9445575-02 0.1 mL (AF350)

NDUFB1 Conjugated Antibody

Sign In for Pricing
View Details