Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnfrsf10b protein

This Mouse Tnfrsf10b protein spans the amino acid sequence from region 53-177aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor superfamily member 10B/Death receptor 5/MK/CD262/Tnfrsf10b/Dr5/Killer

UniProt

Q9QZM4

Expression Region

53-177aa

Tag

C-terminal Fc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 92.04 ng/ml in the presence of 40 ng/mL of TNFSF10.

Form

Lyophilized powder

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTTG siRNA (m)
sc-37492 10 µM

PTTG siRNA (m)

Sign In for Pricing
View Details
Mouse S100A11 ELISA Kit (Colorimetric)
NBP2-68111 1 Kit

Mouse S100A11 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
ST3GAL4 (NM_006278) Human Tagged ORF Clone Lentiviral Particle
RC216090L4V 200 µL

ST3GAL4 (NM_006278) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Melanin Concentrating Hormone Receptor 1 (MCH Receptor 1, MCHR1, MCH-R1, MCHR-1, MCH1R, MCH-1R, MCHR, G-protein Coupled Receptor 24, GPR24, MGC32129, Somatostatin Receptor-like Protein, SLC1, SLC-1) (MaxLight 650)
129572-ML650 100 µL

Melanin Concentrating Hormone Receptor 1 (MCH Receptor 1, MCHR1, MCH-R1, MCHR-1, MCH1R, MCH-1R, MCHR, G-protein Coupled Receptor 24, GPR24, MGC32129, Somatostatin Receptor-like Protein, SLC1, SLC-1) (MaxLight 650)

Sign In for Pricing
View Details
PDIA5 Knockout 786-O Polyclonal Cells
ARG5699 1 Million

PDIA5 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
KIAA0556 Rabbit Polyclonal Antibody (BF555)
orb2494648 100 µL

KIAA0556 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details