Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnfrsf10b protein

This Mouse Tnfrsf10b protein spans the amino acid sequence from region 53-177aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor superfamily member 10B/Death receptor 5/MK/CD262/Tnfrsf10b/Dr5/Killer

UniProt

Q9QZM4

Expression Region

53-177aa

Tag

C-terminal Fc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 92.04 ng/ml in the presence of 40 ng/mL of TNFSF10.

Form

Lyophilized powder

Molecular Weight

40.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NTS2/NTSR2 Antibody [DyLight 405]
NB100-56472V 0.1 mL

Rabbit Polyclonal NTS2/NTSR2 Antibody [DyLight 405]

Sign In for Pricing
View Details
ADAMTS4 293 Cell Lysate
408198 0.1 mg

ADAMTS4 293 Cell Lysate

Sign In for Pricing
View Details
RAMP2 Antibody
37019 100 µL

RAMP2 Antibody

Sign In for Pricing
View Details
PAX6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
36062066 1.0 µg DNA

PAX6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
U2AF1L3/35 (D-4) HRP
sc-514459 HRP 200 µg/mL

U2AF1L3/35 (D-4) HRP

Sign In for Pricing
View Details
Ndufa13 (NM_023312) Mouse Tagged ORF Clone
MG200955 10 µg

Ndufa13 (NM_023312) Mouse Tagged ORF Clone

Sign In for Pricing
View Details