Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnf protein

This Mouse Tnf protein spans the amino acid sequence from region 89-235aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2

UniProt

P06804

Expression Region

89-235aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cytotoxicity assay using L‐929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 2-8 pg/ml.

Form

Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTBP1 (NM_031991) Human Over-expression Lysate
LC410401 20 µg

PTBP1 (NM_031991) Human Over-expression Lysate

Sign In for Pricing
View Details
CHO Monoclonal MUC1 Antibody (clivatuzumab) - Humanized - (Dry Ice)
NBP3-28080-50ug 50 µg

CHO Monoclonal MUC1 Antibody (clivatuzumab) - Humanized - (Dry Ice)

Sign In for Pricing
View Details
FGF2 Rabbit Polyclonal Antibody
orb578305 100 µL

FGF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse mLec activation kit by CRISPRa
GA212194 1 Kit

Mouse mLec activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-Human CDH11 Antibody (SAA1820)
RHF12001 100 μg

Anti-Human CDH11 Antibody (SAA1820)

Sign In for Pricing
View Details
C15orf60 Protein Vector (Human) (pPM-N-D-C-His)
PV329061 500 ng

C15orf60 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details