Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnf protein

This Mouse Tnf protein spans the amino acid sequence from region 89-235aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2

UniProt

P06804

Expression Region

89-235aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cytotoxicity assay using L‐929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 2-8 pg/ml.

Form

Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK6 (Cell Division Protein Kinase 6, Serine/Threonine-protein Kinase PLSTIRE, Crk2, MGC59692) (PE)
MBS6373564-01 0.1 mL

CDK6 (Cell Division Protein Kinase 6, Serine/Threonine-protein Kinase PLSTIRE, Crk2, MGC59692) (PE)

Sign In for Pricing
View Details
CDK6 (Cell Division Protein Kinase 6, Serine/Threonine-protein Kinase PLSTIRE, Crk2, MGC59692) (PE)
MBS6373564-02 5x 0.1 mL

CDK6 (Cell Division Protein Kinase 6, Serine/Threonine-protein Kinase PLSTIRE, Crk2, MGC59692) (PE)

Sign In for Pricing
View Details
KCP (NM_001135914) Human Over-expression Lysate
LS375616 100 µg

KCP (NM_001135914) Human Over-expression Lysate

Sign In for Pricing
View Details
ZBTB7C (Zinc Finger and BTB Domain-Containing Protein 7C, Affected by papillomavirus DNA integration in ME180 Cells Protein 1, APM-1, Zinc Finger and BTB Domain-Containing Protein 36, Zinc Finger Protein 857C, ZBTB7C, APM1, ZBTB36, ZNF857C) (MaxLight 650) discontinued
302850-ML650 100 µL

ZBTB7C (Zinc Finger and BTB Domain-Containing Protein 7C, Affected by papillomavirus DNA integration in ME180 Cells Protein 1, APM-1, Zinc Finger and BTB Domain-Containing Protein 36, Zinc Finger Protein 857C, ZBTB7C, APM1, ZBTB36, ZNF857C) (MaxLight 650) discontinued

Sign In for Pricing
View Details
PDCL2 Double Nickase Plasmid (m)
sc-429774-NIC 20 µg

PDCL2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
FAM54B 3'UTR Luciferase Stable Cell Line
TU007339 1.0 mL

FAM54B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details