Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnf protein

This Mouse Tnf protein spans the amino acid sequence from region 89-235aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2

UniProt

P06804

Expression Region

89-235aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cytotoxicity assay using L‐929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 2-8 pg/ml.

Form

Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Klhdc10 shRNA (UAS) - Lentiviral mouse Klhdc10 shRNA (UAS, RFP) (100)
GTR15194304 1 Vial

Lentiviral mouse Klhdc10 shRNA (UAS) - Lentiviral mouse Klhdc10 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Luc7l siRNA Oligos set (Mouse)
27777174 3x 5 nmol

Luc7l siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Anti-CD44 antibody
PAab01483 100 µg

Anti-CD44 antibody

Sign In for Pricing
View Details
C1qL2 shRNA (m) Lentiviral Particles
sc-141844-V 200 µL

C1qL2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Frizzled 2 (FZD2) (MaxLight 650)
F6401-09A-ML650 100 µL

Frizzled 2 (FZD2) (MaxLight 650)

Sign In for Pricing
View Details
SCN4B (Sodium Channel Subunit beta-4, SCN4B) (MaxLight 650)
MBS6459118-01 0.1 mL

SCN4B (Sodium Channel Subunit beta-4, SCN4B) (MaxLight 650)

Sign In for Pricing
View Details