Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnf protein

This Mouse Tnf protein spans the amino acid sequence from region 89-235aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Tumor Necrosis Factor; Membrane Form; Tumor Necrosis Factor; Soluble Form; Tnf; Tnfa; Tnfsf2

UniProt

P06804

Expression Region

89-235aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cytotoxicity assay using L‐929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 2-8 pg/ml.

Form

Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR81 / FKSG80 Immunizing Peptide
MBS425147-01 0.1 mg

GPR81 / FKSG80 Immunizing Peptide

Sign In for Pricing
View Details
GPR81 / FKSG80 Immunizing Peptide
MBS425147-02 5x 0.1 mg

GPR81 / FKSG80 Immunizing Peptide

Sign In for Pricing
View Details
Bovine BCL-6 corepressor (BCOR) ELISA Kit
OM622941 96 Strip Well

Bovine BCL-6 corepressor (BCOR) ELISA Kit

Sign In for Pricing
View Details
Mouse Rtl4 Pre-designed siRNA Set A
SI112363A 1 Each

Mouse Rtl4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit PSME1 Antibody
orb1524049-01 10 µL

Rabbit PSME1 Antibody

Sign In for Pricing
View Details
Rabbit PSME1 Antibody
orb1524049-02 100 µL

Rabbit PSME1 Antibody

Sign In for Pricing
View Details