Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF10C protein

This Human TNFRSF10C protein spans the amino acid sequence from region 26-221aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor Receptor Superfamily Member 10C; Antagonist Decoy Receptor for TRAIL/Apo-2L; Decoy TRAIL Receptor Without Death Domain; Decoy Receptor 1; DcR1; Lymphocyte Inhibitor of TRAIL; TNF-Related Apoptosis-Inducing Ligand Receptor 3; TRAIL Receptor 3; TRAIL-R3; TRAIL Receptor Without an Intracellular Domain; CD263; TNFRSF10C; DCR1; LIT; TRAILR3; TRID

UniProt

O14798

Expression Region

26-221aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 0.56 ng/ml.

Form

Lyophilized powder

Molecular Weight

21.78 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

AA Sequence

ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Papilloma Virus Type 11 (HPV) (AP) discontinued
P3105-30B-AP 100 µL

Human Papilloma Virus Type 11 (HPV) (AP) discontinued

Sign In for Pricing
View Details
EIF5A (NM_001970) Human Over-expression Lysate
LS001984-20ug 20 µg

EIF5A (NM_001970) Human Over-expression Lysate

Sign In for Pricing
View Details
GDF6, CT (Growth/Differentiation Factor 6, GDF-6, Growth/Differentiation Factor 16, GDF16)
G8989-46 200 µL

GDF6, CT (Growth/Differentiation Factor 6, GDF-6, Growth/Differentiation Factor 16, GDF16)

Sign In for Pricing
View Details
MDK Rabbit Polyclonal Antibody
orb585639 100 µL

MDK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TM (Thrombin) Chicken ELISA Kit
H6431 96 Tests

TM (Thrombin) Chicken ELISA Kit

Sign In for Pricing
View Details
Anti-CD3e (T-Cell Marker) Monoclonal Antibody (Clone: rC3e/1931)
36-3474-20 20 µg

Anti-CD3e (T-Cell Marker) Monoclonal Antibody (Clone: rC3e/1931)

Sign In for Pricing
View Details