Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LTA protein

This Human LTA protein spans the amino acid sequence from region 35-205aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necrosis Factor Ligand Superfamily Member 1; LTA; TNFB; TNFSF1

UniProt

P01374

Expression Region

35-205aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cytotoxicity assay using L‐929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 20-80 pg/ml.

Form

Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PPAN-P2RY11 qPCR Primer Pair
QH81281S 200 Tests

Human PPAN-P2RY11 qPCR Primer Pair

Sign In for Pricing
View Details
LRP16 Double Nickase Plasmid (h2)
sc-405616-NIC-2 20 µg

LRP16 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Anti-Adrenergic Receptor Alpha 2c Antibody
MBS500234-01 0.1 mL

Anti-Adrenergic Receptor Alpha 2c Antibody

Sign In for Pricing
View Details
Anti-Adrenergic Receptor Alpha 2c Antibody
MBS500234-02 5x 0.1 mL

Anti-Adrenergic Receptor Alpha 2c Antibody

Sign In for Pricing
View Details
Rac-3-[ (2R,5S) -5-Carbamoyloxolan-2-yl]propanoic acid
PID24536-01 100 mg

Rac-3-[ (2R,5S) -5-Carbamoyloxolan-2-yl]propanoic acid

Sign In for Pricing
View Details
Rac-3-[ (2R,5S) -5-Carbamoyloxolan-2-yl]propanoic acid
PID24536-02 1 g

Rac-3-[ (2R,5S) -5-Carbamoyloxolan-2-yl]propanoic acid

Sign In for Pricing
View Details