Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LTA protein

This Human LTA protein spans the amino acid sequence from region 35-205aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necrosis Factor Ligand Superfamily Member 1; LTA; TNFB; TNFSF1

UniProt

P01374

Expression Region

35-205aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cytotoxicity assay using L‐929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 20-80 pg/ml.

Form

Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MORF4LP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1317607 1.0 µg DNA

MORF4LP2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mouse Monoclonal Semaphorin 4A Antibody (741531) [PerCP]
FAB4694C 0.1 mL

Mouse Monoclonal Semaphorin 4A Antibody (741531) [PerCP]

Sign In for Pricing
View Details
HCP5P10 sgRNA CRISPR Lentivector (Human) (Target 3)
K0939004 1.0 µg DNA

HCP5P10 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human BTD knockdown cell line
ABC-KD1602 1 Vial

Human BTD knockdown cell line

Sign In for Pricing
View Details
Recombinant Complement Factor H Related Protein 3 (CFHR3)
TRV-0006411-01 10 µg

Recombinant Complement Factor H Related Protein 3 (CFHR3)

Sign In for Pricing
View Details
Recombinant Complement Factor H Related Protein 3 (CFHR3)
TRV-0006411-02 50 µg

Recombinant Complement Factor H Related Protein 3 (CFHR3)

Sign In for Pricing
View Details