Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LTA protein

This Human LTA protein spans the amino acid sequence from region 35-205aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necrosis Factor Ligand Superfamily Member 1; LTA; TNFB; TNFSF1

UniProt

P01374

Expression Region

35-205aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cytotoxicity assay using L‐929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 20-80 pg/ml.

Form

Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1024 shRNA (m) Lentiviral Particles
sc-140893-V 200 µL

KIAA1024 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Anti-PCDHA13 Antibody Picoband®, HRP Conjugate
A16196-1-HRP 100 µg/Vial

Anti-PCDHA13 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Lentiviral mouse Rgs1 shRNA (UAS) - Lentiviral mouse Rgs1 shRNA (UAS, iRFP) plasmid
GTR15218512 1 Vial

Lentiviral mouse Rgs1 shRNA (UAS) - Lentiviral mouse Rgs1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
CDKN1C antibody
orb254634-01 50 μL

CDKN1C antibody

Sign In for Pricing
View Details
CDKN1C antibody
orb254634-02 100 µL

CDKN1C antibody

Sign In for Pricing
View Details
STNL W004-210x297-PP-CRD/1 Electrical & Equipment Safety Signs (No Adhesive)
826952 1 Card (1 Panel (s) x 1 Pack)

STNL W004-210x297-PP-CRD/1 Electrical & Equipment Safety Signs (No Adhesive)

Sign In for Pricing
View Details