Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF10B protein

This Human TNFRSF10B protein spans the amino acid sequence from region 56-182aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor Receptor Superfamily Member 10B; Death Receptor 5; TNF-Related Apoptosis-Inducing Ligand Receptor 2; TRAIL Receptor 2; TRAIL-R2; CD262; TNFRSF10B; DR5; KILLER; TRAILR2; TRICK2; ZTNFR9

UniProt

O14763

Expression Region

56-182aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 9.96 ng/ml.

Form

Lyophilized powder

Molecular Weight

15.19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein
E45H38788M5 20 µg

Secretory lectin ZG16 (ZG16) (NM_152338) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal to Human CDA / Cytidine Deaminase
MBS241714-01 0.05 mg

Rabbit Polyclonal to Human CDA / Cytidine Deaminase

Sign In for Pricing
View Details
Rabbit Polyclonal to Human CDA / Cytidine Deaminase
MBS241714-02 5x 0.05 mg

Rabbit Polyclonal to Human CDA / Cytidine Deaminase

Sign In for Pricing
View Details
Mouse Purinergic Receptor P2X Ligand-Gated Ion Channel 7 (P2RX7) ELISA Kit
MBS3807516-01 48 Well

Mouse Purinergic Receptor P2X Ligand-Gated Ion Channel 7 (P2RX7) ELISA Kit

Sign In for Pricing
View Details
Mouse Purinergic Receptor P2X Ligand-Gated Ion Channel 7 (P2RX7) ELISA Kit
MBS3807516-02 96 Well

Mouse Purinergic Receptor P2X Ligand-Gated Ion Channel 7 (P2RX7) ELISA Kit

Sign In for Pricing
View Details
Mouse Purinergic Receptor P2X Ligand-Gated Ion Channel 7 (P2RX7) ELISA Kit
MBS3807516-03 5x 96 Well

Mouse Purinergic Receptor P2X Ligand-Gated Ion Channel 7 (P2RX7) ELISA Kit

Sign In for Pricing
View Details