Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF10B protein

This Human TNFRSF10B protein spans the amino acid sequence from region 56-182aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor Necrosis Factor Receptor Superfamily Member 10B; Death Receptor 5; TNF-Related Apoptosis-Inducing Ligand Receptor 2; TRAIL Receptor 2; TRAIL-R2; CD262; TNFRSF10B; DR5; KILLER; TRAILR2; TRICK2; ZTNFR9

UniProt

O14763

Expression Region

56-182aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 9.96 ng/ml.

Form

Lyophilized powder

Molecular Weight

15.19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K777
BA1645-5.1 1 mL (10 mM in DMSO)

K777

Sign In for Pricing
View Details
Kcnj3 Rabbit Polyclonal Antibody
TA355733 100 µL

Kcnj3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thrombin Inhibitor 2 1mg
A21814-1 1 mg

Thrombin Inhibitor 2 1mg

Sign In for Pricing
View Details
MED7, ID (MED7, ARC34, CRSP9, Mediator of RNA polymerase II transcription subunit 7, Activator-recruited cofactor 34kD component, Cofactor required for Sp1 transcriptional activation subunit 9, Mediator complex subunit 7, RNA polymerase transcriptional re
MBS6320057-01 0.2 mL

MED7, ID (MED7, ARC34, CRSP9, Mediator of RNA polymerase II transcription subunit 7, Activator-recruited cofactor 34kD component, Cofactor required for Sp1 transcriptional activation subunit 9, Mediator complex subunit 7, RNA polymerase transcriptional re

Sign In for Pricing
View Details
MED7, ID (MED7, ARC34, CRSP9, Mediator of RNA polymerase II transcription subunit 7, Activator-recruited cofactor 34kD component, Cofactor required for Sp1 transcriptional activation subunit 9, Mediator complex subunit 7, RNA polymerase transcriptional re
MBS6320057-02 5x 0.2 mL

MED7, ID (MED7, ARC34, CRSP9, Mediator of RNA polymerase II transcription subunit 7, Activator-recruited cofactor 34kD component, Cofactor required for Sp1 transcriptional activation subunit 9, Mediator complex subunit 7, RNA polymerase transcriptional re

Sign In for Pricing
View Details
Human UIMC1 Knockout A549 cell line
GTR15410062 1 Vial

Human UIMC1 Knockout A549 cell line

Sign In for Pricing
View Details