Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TNFRSF1B protein

This Human TNFRSF1B protein spans the amino acid sequence from region 23-257aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor type II; p75; p80 TNF-alpha receptor; TBP-2; TBPII; TNFRSF1B; TNFBR; TNFR2

UniProt

P20333

Expression Region

23-257aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human TNF alpha at 5μg/ml can bind Recombinant Human TNF RII (C-6His), the ED50 of Recombinant Human TNF RII (C-6His) is 0.212 ug/ml.

Form

Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NuMA Mouse Monoclonal Antibody [PSH03-07] - BSA and Azide free (Capture)
HA601223 100 µg

NuMA Mouse Monoclonal Antibody [PSH03-07] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
Cfap57 Mouse Gene Knockout Kit (CRISPR)
KN519379 1 Kit

Cfap57 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Gelsolin Polyclonal Antibody
E-AB-40539-01 25 µL

Gelsolin Polyclonal Antibody

Sign In for Pricing
View Details
Gelsolin Polyclonal Antibody
E-AB-40539-02 100 µL

Gelsolin Polyclonal Antibody

Sign In for Pricing
View Details
C14orf38 (CCDC175) Human Gene Knockout Kit (CRISPR)
KN428583 1 Kit

C14orf38 (CCDC175) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Isopropyl Acetate-d10
TRC-I823417-25MG 25 mg

Isopropyl Acetate-d10

Sign In for Pricing
View Details