Human TNFRSF1B protein
This Human TNFRSF1B protein spans the amino acid sequence from region 23-257aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor type II; p75; p80 TNF-alpha receptor; TBP-2; TBPII; TNFRSF1B; TNFBR; TNFR2
UniProt
P20333
Expression Region
23-257aa
Tag
C-terminal 6xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human TNF alpha at 5μg/ml can bind Recombinant Human TNF RII (C-6His), the ED50 of Recombinant Human TNF RII (C-6His) is 0.212 ug/ml.
Form
Lyophilized powder
Molecular Weight
26.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Extracellular Domain
Preservative
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
AA Sequence
LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Elab Fluor® 700 Anti-Human CD19 Antibody[HI19a]](https://cdn.genprice.uk/products/763/68dd14a5061270361e7d1783/imageurl/e-ab-f1304m1.webp)
E-AB-F1304M1-01 20 Tests
Elab Fluor® 700 Anti-Human CD19 Antibody[HI19a]
Sign In for Pricing
View Details E-AB-F1304M1-02 100 Tests
Elab Fluor® 700 Anti-Human CD19 Antibody[HI19a]
Sign In for Pricing
View Details E-AB-F1304M1-03 2x 100 Tests
Elab Fluor® 700 Anti-Human CD19 Antibody[HI19a]
Sign In for Pricing
View Details 
