Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RANKL protein

This Human RANKL protein spans the amino acid sequence from region 140-317aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD254; ODF; OPGL; RANK L; TNFSF11; CD254; Osteoclast differentiation factor; Receptor activator of nuclear factor kappa-B ligand; tumor necrosis factor ligand superfamily member 11

UniProt

O14788

Expression Region

140-317aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

1Loaded Recombinant Human OPG-Fc on Pro A Biosensor, can bind Human RANKL with an affinity constant of 1.83 pM as determined in BLI assay. 2Loaded Human RANK-His on HIS1K Biosensor, can bind Human RANK L with an affinity constant of <1 pM as determined in BLI assay.

Form

Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0

AA Sequence

IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIO2 Blocking Peptide
MBS9621645-01 1 mg

DIO2 Blocking Peptide

Sign In for Pricing
View Details
DIO2 Blocking Peptide
MBS9621645-02 5x 1 mg

DIO2 Blocking Peptide

Sign In for Pricing
View Details
TRIM54 Antibody, Biotin conjugated
CSB-PA861180LD01HU-01 50 µg

TRIM54 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TRIM54 Antibody, Biotin conjugated
CSB-PA861180LD01HU-02 100 µg

TRIM54 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Human hsa-miR-4726-5p miRNA Agomir
abx881578-01 5 nmol

Human hsa-miR-4726-5p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-4726-5p miRNA Agomir
abx881578-02 10 nmol

Human hsa-miR-4726-5p miRNA Agomir

Sign In for Pricing
View Details