Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il10 protein

This Mouse Il10 protein spans the amino acid sequence from region 19-178aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-10; Il10; IL-10; Cytokine synthesis inhibitory factor; CSIF

UniProt

P18893

Expression Region

19-178aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using FDC-P1 Mouse bone marrow cells is 6 ng/ml.

Form

Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAI2 Antibody
orb1265154 400 μl

DNAI2 Antibody

Sign In for Pricing
View Details
Mouse Anti Rabbit Cd4 Monoclonal Antibody
CABT-45169MR 2 ml

Mouse Anti Rabbit Cd4 Monoclonal Antibody

Sign In for Pricing
View Details
D53 CRISPR Activation Plasmid (m)
sc-423478-ACT 20 µg

D53 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Lentiviral mouse Chrdl1 shRNA (UAS) - Lentiviral mouse Chrdl1 shRNA (UAS) plasmid
GTR15129571 1 Vial

Lentiviral mouse Chrdl1 shRNA (UAS) - Lentiviral mouse Chrdl1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
ATF6 Polyclonal Antibody, Cy3 Conjugated
bs-23093R-Cy3 100 µL

ATF6 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Rat Complement C3 (C3) CLIA Kit
abx492152-01 96 Tests

Rat Complement C3 (C3) CLIA Kit

Sign In for Pricing
View Details