Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il10 protein

This Mouse Il10 protein spans the amino acid sequence from region 19-178aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-10; Il10; IL-10; Cytokine synthesis inhibitory factor; CSIF

UniProt

P18893

Expression Region

19-178aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using FDC-P1 Mouse bone marrow cells is 6 ng/ml.

Form

Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERN1 Antibody, FITC conjugated
MBS7048139-01 0.05 mg

ERN1 Antibody, FITC conjugated

Sign In for Pricing
View Details
ERN1 Antibody, FITC conjugated
MBS7048139-02 0.1 mg

ERN1 Antibody, FITC conjugated

Sign In for Pricing
View Details
ERN1 Antibody, FITC conjugated
MBS7048139-03 5x 0.1 mg

ERN1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Olfr270 (NM_146607) Mouse Tagged Lenti ORF Clone
MR213320L3 10 µg

Olfr270 (NM_146607) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Urocortin II, human (TFA)
HY-P1752A 1 Each

Urocortin II, human (TFA)

Sign In for Pricing
View Details
FABP antibody (HRP)
70R-15344 0.1 mg

FABP antibody (HRP)

Sign In for Pricing
View Details