Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL4 protein

This Mouse IL4 protein spans the amino acid sequence from region 21-140aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-4; IL-4; IL4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; BSF-1; IGG1 induction factor; Lymphocyte stimulatory factor 1

UniProt

P07750

Expression Region

21-140aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.035 ng/ml.

Form

Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum Amyloid A Antibody
orb2719883 100 µL

Serum Amyloid A Antibody

Sign In for Pricing
View Details
Diphacinone-d4 (indanedione-4,5,6,7-d4)
TRC-D486961-1MG 1 mg

Diphacinone-d4 (indanedione-4,5,6,7-d4)

Sign In for Pricing
View Details
Rabbit anti-Human LILRB1 mAb (DET)
RM17934 100 µg

Rabbit anti-Human LILRB1 mAb (DET)

Sign In for Pricing
View Details
Dcun1d2 3'UTR Lenti-reporter-Luc Vector
17758084 1.0 µg

Dcun1d2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Human CD179A/VPREB1 Protein, His Tag
E40KMH361 20 µg

Recombinant Human CD179A/VPREB1 Protein, His Tag

Sign In for Pricing
View Details
FBXO33 3'UTR GFP Stable Cell Line
TU057795 1.0 mL

FBXO33 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details