Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL4 protein

This Mouse IL4 protein spans the amino acid sequence from region 23-140aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; IGG1 induction factor; Lymphocyte stimulatory factor 1; IL-4; BSF-1

UniProt

P07750

Expression Region

23-140aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.01 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5.

AA Sequence

HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCA5 C-terminal Rabbit mAb
F2504-20uL 20 µL

CDCA5 C-terminal Rabbit mAb

Sign In for Pricing
View Details
Tumor necrosis factor
orb1635658-01 50 µg

Tumor necrosis factor

Sign In for Pricing
View Details
Tumor necrosis factor
orb1635658-02 100 µg

Tumor necrosis factor

Sign In for Pricing
View Details
Tumor necrosis factor
orb1635658-03 1 mg

Tumor necrosis factor

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Interferon Gamma Induced Protein 10kDa (IP10)
TRV-0022075-01 200 µL

FITC-Linked Polyclonal Antibody to Interferon Gamma Induced Protein 10kDa (IP10)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Interferon Gamma Induced Protein 10kDa (IP10)
TRV-0022075-02 1 mL

FITC-Linked Polyclonal Antibody to Interferon Gamma Induced Protein 10kDa (IP10)

Sign In for Pricing
View Details