Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il7 protein

This Mouse Il7 protein spans the amino acid sequence from region 26-154aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoietin -1; PBGF

UniProt

P10168

Expression Region

26-154aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 60-1000 pg/ml.

Form

Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bomapin siRNA (h)
sc-106812 10 µM

Bomapin siRNA (h)

Sign In for Pricing
View Details
CK2 beta Antibody
E38PA1286 100 µL

CK2 beta Antibody

Sign In for Pricing
View Details
MAN2B1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1260107 1.0 µg DNA

MAN2B1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral mouse Sestd1 shRNA (UAS) - Lentiviral mouse Sestd1 shRNA (UAS, iRFP) (100)
GTR15251907 1 Vial

Lentiviral mouse Sestd1 shRNA (UAS) - Lentiviral mouse Sestd1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human PTRH2 AssayLite™ Antibody (FITC Conjugate)
33022-05141 2x 75 µg

Human PTRH2 AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
CTLA4 Mouse Monoclonal Antibody [Clone ID: LBI2E9]
AMM21111V 100 µL

CTLA4 Mouse Monoclonal Antibody [Clone ID: LBI2E9]

Sign In for Pricing
View Details