Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il7 protein

This Mouse Il7 protein spans the amino acid sequence from region 26-154aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoietin -1; PBGF

UniProt

P10168

Expression Region

26-154aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 60-1000 pg/ml.

Form

Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICP Std Thulium 1000ug/mL in 2-5% HNO3
PTM2A2-01 100 mL

ICP Std Thulium 1000ug/mL in 2-5% HNO3

Sign In for Pricing
View Details
ICP Std Thulium 1000ug/mL in 2-5% HNO3
PTM2A2-02 500 mL

ICP Std Thulium 1000ug/mL in 2-5% HNO3

Sign In for Pricing
View Details
TCF3, CT (TCF3, BHLHB21, E2A, ITF1, Transcription factor E2-alpha, Class B basic helix-loop-helix protein 21, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, Kappa-E2-binding factor, Transcription factor 3, Transcription factor ITF-1) (MaxLight 405) discontinued
042697-ML405 100 µL

TCF3, CT (TCF3, BHLHB21, E2A, ITF1, Transcription factor E2-alpha, Class B basic helix-loop-helix protein 21, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, Kappa-E2-binding factor, Transcription factor 3, Transcription factor ITF-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
HSP90AB2P sgRNA CRISPR Lentivector set (Human)
K0996701 3x 1.0 µg

HSP90AB2P sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
TECTB Rabbit Polyclonal Antibody (BF594)
orb2547960 100 µL

TECTB Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Cntrob 3'UTR Luciferase Stable Cell Line
TU202587 1.0 mL

Cntrob 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details