Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Il7 protein

This Mouse Il7 protein spans the amino acid sequence from region 26-154aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-7; IL-7 interleukin-7; interleukin-7; Lymphopoietin -1; PBGF

UniProt

P10168

Expression Region

26-154aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 60-1000 pg/ml.

Form

Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALL3 Polyclonal Antibody
UB-GEN-5272 100 µL

CALL3 Polyclonal Antibody

Sign In for Pricing
View Details
SLAMF6 Rabbit Polyclonal Antibody (FITC)
orb2111982 100 µL

SLAMF6 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
TM2D3 Antibody, FITC conjugated
A66891-50UG 50 µg

TM2D3 Antibody, FITC conjugated

Sign In for Pricing
View Details
CD41/ITGA2B Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-2636R-BF488-TR 20 µL

CD41/ITGA2B Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Mouse Ceruloplasmin (CP) CLIA Kit
abx195412-01 96 Tests

Mouse Ceruloplasmin (CP) CLIA Kit

Sign In for Pricing
View Details
Mouse Ceruloplasmin (CP) CLIA Kit
abx195412-02 5x 96 Tests

Mouse Ceruloplasmin (CP) CLIA Kit

Sign In for Pricing
View Details