Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL13 protein

This Mouse IL13 protein spans the amino acid sequence from region 26-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13

UniProt

P20109

Expression Region

26-131aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is 1.93 ng/ml.

Form

Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Smooth Muscle Myosin Heavy Chain (SM-MHC) (Leiomyosarcoma & Myoepithelial Cell Marker)
36-1486-100 100 µg

Monoclonal Antibody to Smooth Muscle Myosin Heavy Chain (SM-MHC) (Leiomyosarcoma & Myoepithelial Cell Marker)

Sign In for Pricing
View Details
Anti-Mouse IgG (H+L), Rat Serum Adsorbed - 30nm Gold Conjugate
AC-30-16-05 0.5 mL

Anti-Mouse IgG (H+L), Rat Serum Adsorbed - 30nm Gold Conjugate

Sign In for Pricing
View Details
CAMK1D Rabbit Polyclonal Antibody (PE-Cy7)
orb890253 100 µL

CAMK1D Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
COX6B1P5 3'UTR GFP Stable Cell Line
TU054889 1.0 mL

COX6B1P5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human Cathepsin H (CTSH) ELISA Kit
AE63202HU-01 48 Tests

Human Cathepsin H (CTSH) ELISA Kit

Sign In for Pricing
View Details
Human Cathepsin H (CTSH) ELISA Kit
AE63202HU-02 96 Tests

Human Cathepsin H (CTSH) ELISA Kit

Sign In for Pricing
View Details