Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL13 protein

This Mouse IL13 protein spans the amino acid sequence from region 22-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13

UniProt

P20109

Expression Region

22-131aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 11.34 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnfsf8 Rabbit Monoclonal Antibody [Clone ID: RM153]
TA386238 200 µg

Tnfsf8 Rabbit Monoclonal Antibody [Clone ID: RM153]

Sign In for Pricing
View Details
TRAF3IP3 antibody
70R-6634 50 ug

TRAF3IP3 antibody

Sign In for Pricing
View Details
NEDD4L AAV Vector (Human) (CMV)
31683101 1 µg

NEDD4L AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Geranylgeranyl Diphosphate Synthase 1 (GGPS1) Antibody (FITC)
abx303950-01 20 µg

Geranylgeranyl Diphosphate Synthase 1 (GGPS1) Antibody (FITC)

Sign In for Pricing
View Details
Geranylgeranyl Diphosphate Synthase 1 (GGPS1) Antibody (FITC)
abx303950-02 50 µg

Geranylgeranyl Diphosphate Synthase 1 (GGPS1) Antibody (FITC)

Sign In for Pricing
View Details
Geranylgeranyl Diphosphate Synthase 1 (GGPS1) Antibody (FITC)
abx303950-03 100 µg

Geranylgeranyl Diphosphate Synthase 1 (GGPS1) Antibody (FITC)

Sign In for Pricing
View Details