Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL13 protein

This Mouse IL13 protein spans the amino acid sequence from region 22-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13

UniProt

P20109

Expression Region

22-131aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 11.34 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rab42 shRNA (UAS) - Lentiviral mouse Rab42 shRNA (UAS, RFP) (100)
GTR15271296 1 Vial

Lentiviral mouse Rab42 shRNA (UAS) - Lentiviral mouse Rab42 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
SLIT2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-2743R-BF680-01 20 µL

SLIT2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
SLIT2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-2743R-BF680-02 100 µL

SLIT2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Human MICOS10-NBL1 activation kit by CRISPRa
GA119376 1 Kit

Human MICOS10-NBL1 activation kit by CRISPRa

Sign In for Pricing
View Details
LCE1C ORF Vector (Human) (pORF)
ORF022629 1.0 µg DNA

LCE1C ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Zfp748 Protein Vector (Mouse) (pPM-C-His)
PV250169 500 ng

Zfp748 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details