Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse IL13 protein

This Mouse IL13 protein spans the amino acid sequence from region 22-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13

UniProt

P20109

Expression Region

22-131aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 11.34 ng/ml.

Form

Lyophilized powder

Molecular Weight

13.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

PVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pipox shRNA (UAS) - Lentiviral mouse Pipox shRNA (UAS) plasmid
GTR15303274 1 Vial

Lentiviral mouse Pipox shRNA (UAS) - Lentiviral mouse Pipox shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human RING finger protein 170, RNF170 ELISA KIT
ELI-14675h 96 Tests

Human RING finger protein 170, RNF170 ELISA KIT

Sign In for Pricing
View Details
Siglec15, Fc Fusion, Avi-tag, Biotin-labeled
100424-2 50 µg

Siglec15, Fc Fusion, Avi-tag, Biotin-labeled

Sign In for Pricing
View Details
LAPTM4B Antibody
orb1254965 100 µL

LAPTM4B Antibody

Sign In for Pricing
View Details
Human Monoclonal B7-H4 Antibody (Millennium patent anti-B7-H4) [Janelia Fluor 525]
NBP3-28513JF525 0.1 mL

Human Monoclonal B7-H4 Antibody (Millennium patent anti-B7-H4) [Janelia Fluor 525]

Sign In for Pricing
View Details
Non Vacuum Sodium citrate 3.2% 2.7ml / 1.8ml
14 3600 PCS/Pack

Non Vacuum Sodium citrate 3.2% 2.7ml / 1.8ml

Sign In for Pricing
View Details