What is the catalog number for Human IL17A & IL17F protein?

The catalog number for Human IL17A & IL17F protein is orb594824.

What sizes are available for Human IL17A & IL17F protein?

Human IL17A & IL17F protein is available in the following size(s): 10 µg, 50 µg, 500 µg, 1 mg.

How many pack sizes does Human IL17A & IL17F protein come in?

Human IL17A & IL17F protein is available in 4 different pack sizes.

Is Human IL17A & IL17F protein in stock?

Human IL17A & IL17F protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human IL17A & IL17F protein

This Human IL17A & IL17F protein spans the amino acid sequence from region 24-155aa & 31-163aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL‐17A/F Heterodimer; IL-17A&IL-17F Heterodimer

UniProt

Q16552

Expression Region

24-155aa&31-163aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Loaded Biotinylated Human IL-17RA -His-Avi on SA Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 8.6 pM as determined in BLI assay. 2Loaded Biotinylated Human IL-17RA-Fc on Pro A Biosensor, can bind Human IL-17A&17F-His with an affinity constant of 10.3 nM as determined in BLI assay.

Form

Lyophilized powder

Molecular Weight

15.1kDa & 16.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Heterodimer

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA &RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ