Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL36G protein

This Human IL36G protein spans the amino acid sequence from region 18-169aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1RP2; IL-1 epsilon; IL-1F9; Interleukin-1 homolog 1; IL-1H1

UniProt

Q9NZH8

Expression Region

18-169aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells is 5-20 ng/ml.

Form

Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8.0

AA Sequence

SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTP1 Mouse Monoclonal Antibody
orb2280246-01 50 µg

GSTP1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GSTP1 Mouse Monoclonal Antibody
orb2280246-02 100 µg

GSTP1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Kir2.1 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62351R-PerCP-Cy5.5 100 µL

Kir2.1 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Gab1, Phosphorylated (Tyr659) (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) (MaxLight 405)
MBS6477276-01 0.1 mL

Gab1, Phosphorylated (Tyr659) (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) (MaxLight 405)

Sign In for Pricing
View Details
Gab1, Phosphorylated (Tyr659) (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) (MaxLight 405)
MBS6477276-02 5x 0.1 mL

Gab1, Phosphorylated (Tyr659) (GRB2-associated Binder Protein 1, Growth Factor Receptor Bound Protein 2-associated Protein 1, GRB2-associated Binder 1) (MaxLight 405)

Sign In for Pricing
View Details
Mterf3 (NM_199387) Rat Tagged Lenti ORF Clone
RR209973L3 10 µg

Mterf3 (NM_199387) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details