Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL36G protein

This Human IL36G protein spans the amino acid sequence from region 18-169aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1RP2; IL-1 epsilon; IL-1F9; Interleukin-1 homolog 1; IL-1H1

UniProt

Q9NZH8

Expression Region

18-169aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells is 5-20 ng/ml.

Form

Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8.0

AA Sequence

SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Serine-protein kinase ATM ATM Antibody Picoband® (Biotine Conjugate)
RP1040-Biotin 100 µg/Vial

Anti-Serine-protein kinase ATM ATM Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Helicobacter pylori protein
MBS537060-01 1 mg

Helicobacter pylori protein

Sign In for Pricing
View Details
Helicobacter pylori protein
MBS537060-02 5x 1 mg

Helicobacter pylori protein

Sign In for Pricing
View Details
Lentiviral human DDAH1 shRNA (UAS) - Lentiviral human DDAH1 shRNA (UAS, iRFP) (25)
GTR15328937 1 Vial

Lentiviral human DDAH1 shRNA (UAS) - Lentiviral human DDAH1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Recombinant Streptococcus thermophilus Ribosome maturation factor RimP (rimP)
MBS1398607-01 0.02 mg (E-Coli)

Recombinant Streptococcus thermophilus Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details
Recombinant Streptococcus thermophilus Ribosome maturation factor RimP (rimP)
MBS1398607-02 0.1 mg (E-Coli)

Recombinant Streptococcus thermophilus Ribosome maturation factor RimP (rimP)

Sign In for Pricing
View Details