Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL15RA protein

This Human IL15RA protein spans the amino acid sequence from region 31-205aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD215; IL15RA; CD215 antigen; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin 15 receptor; alpha; interleukin-15 receptor subunit alpha; MGC104179

UniProt

Q13261

Expression Region

31-205aa

Tag

C-terminal Fc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‐2 mouse cytotoxic T cells is 0.35-3.5 ng/ml.

Form

Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIKPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melatonin Receptor 1A (MTNR1A) Human shRNA Plasmid Kit (Locus ID 4543)
TL311350 1 Kit

Melatonin Receptor 1A (MTNR1A) Human shRNA Plasmid Kit (Locus ID 4543)

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/1723), CF405S conjugate, 0.1mg/mL
BNC041723-500 1x 500 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/1723), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rabbit Polyclonal CLCN3 Antibody
NBP1-91790 0.1 mL

Rabbit Polyclonal CLCN3 Antibody

Sign In for Pricing
View Details
HCoV-HKU1 nsp10 Gene Tagged ORF Clone
VC100584 10 µg

HCoV-HKU1 nsp10 Gene Tagged ORF Clone

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Human Flt3 ligand (27-185) Membrane Protein, PaRoom Temperatureial
MP0079F Each

Magic™ Antibody Discovery - Human Flt3 ligand (27-185) Membrane Protein, PaRoom Temperatureial

Sign In for Pricing
View Details
OXCT1 Rabbit Polyclonal Antibody (Cy7)
orb1045693 100 µL

OXCT1 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details