Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL15RA protein

This Human IL15RA protein spans the amino acid sequence from region 31-205aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD215; IL15RA; CD215 antigen; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin 15 receptor; alpha; interleukin-15 receptor subunit alpha; MGC104179

UniProt

Q13261

Expression Region

31-205aa

Tag

C-terminal Fc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL‐2 mouse cytotoxic T cells is 0.35-3.5 ng/ml.

Form

Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIKPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON3 Polyclonal Antibody, HRP Conjugated
bs-11782R-HRP 100 µL

PON3 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Anti-CSNK2B Antibody (R3P35)
RHF61502 100 μg

Anti-CSNK2B Antibody (R3P35)

Sign In for Pricing
View Details
Lentiviral human C5orf58 shRNA (UAS) - Lentiviral human C5orf58 shRNA (UAS, iRFP) (100)
GTR15310086 1 Vial

Lentiviral human C5orf58 shRNA (UAS) - Lentiviral human C5orf58 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Bcat1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4797105 3x 1.0 µg

Bcat1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
TWISTNB Human shRNA Plasmid Kit (Locus ID 221830)
TR308555 1 Kit

TWISTNB Human shRNA Plasmid Kit (Locus ID 221830)

Sign In for Pricing
View Details
Western Blot Box (15.2 x 10.2 x 3.2cm)
20930044-1 5 Boxes

Western Blot Box (15.2 x 10.2 x 3.2cm)

Sign In for Pricing
View Details