Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL3 protein

This Human IL3 protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3

UniProt

P08700

Expression Region

20-152aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

1Loaded Human IL-3RA-Fc on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.89uM as determined in BLI assay. 2Loaded Human IL-3RA-Fc-Avi on Protein A Biosensor, can bind Human IL-3 with an affinity constant of 3.74 uM as determined in BLI assay.

Form

Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCE1A, CT (LCE1A, LEP1, Late cornified envelope protein 1A, Late envelope protein 1) (AP)
MBS6315437-01 0.2 mL

LCE1A, CT (LCE1A, LEP1, Late cornified envelope protein 1A, Late envelope protein 1) (AP)

Sign In for Pricing
View Details
LCE1A, CT (LCE1A, LEP1, Late cornified envelope protein 1A, Late envelope protein 1) (AP)
MBS6315437-02 5x 0.2 mL

LCE1A, CT (LCE1A, LEP1, Late cornified envelope protein 1A, Late envelope protein 1) (AP)

Sign In for Pricing
View Details
Bovine Sister chromatid cohesion protein PDS5 homolog A (PDS5A) ELISA Kit
GTR10355815 96 Well

Bovine Sister chromatid cohesion protein PDS5 homolog A (PDS5A) ELISA Kit

Sign In for Pricing
View Details
Recombinant Escherichia coli Queuine tRNA-ribosyltransferase (tgt)
MBS1346220-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details
Recombinant Escherichia coli Queuine tRNA-ribosyltransferase (tgt)
MBS1346220-02 0.02 mg (Yeast)

Recombinant Escherichia coli Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details
Recombinant Escherichia coli Queuine tRNA-ribosyltransferase (tgt)
MBS1346220-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details