Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL3 protein

This Human IL3 protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3

UniProt

P08700

Expression Region

20-152aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 0.3-1.5 ng/ml.

Form

Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Oryza sativa LOC_Os01g43090 pAb
PA12219-01 50 μL

Rabbit Anti-Oryza sativa LOC_Os01g43090 pAb

Sign In for Pricing
View Details
Rabbit Anti-Oryza sativa LOC_Os01g43090 pAb
PA12219-02 100 μL

Rabbit Anti-Oryza sativa LOC_Os01g43090 pAb

Sign In for Pricing
View Details
GK5 Polyclonal Antibody
MBS9238567-01 0.1 mL

GK5 Polyclonal Antibody

Sign In for Pricing
View Details
GK5 Polyclonal Antibody
MBS9238567-02 5x 0.1 mL

GK5 Polyclonal Antibody

Sign In for Pricing
View Details
TRERF1 Antibody
E11-11526CC 100 µg -100 µL

TRERF1 Antibody

Sign In for Pricing
View Details
Recombinant Tri a 14
E4A10Y89 100 µg

Recombinant Tri a 14

Sign In for Pricing
View Details