Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL3 protein

This Human IL3 protein spans the amino acid sequence from region 20-152aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3

UniProt

P08700

Expression Region

20-152aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using TF‐1 human erythroleukemic cells is 0.3-1.5 ng/ml.

Form

Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr102 Double Nickase Plasmid (m2)
sc-434398-NIC-2 20 µg

Olfr102 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
TRNAQ1-set siRNA/shRNA/RNAi Lentivector (Human)
48278091 4x 500 ng

TRNAQ1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
CAMK1D Antibody
22-996 100 µL

CAMK1D Antibody

Sign In for Pricing
View Details
Bovine Cortisol ELISA Kit
orb1671164 96 Tests

Bovine Cortisol ELISA Kit

Sign In for Pricing
View Details
ARMCX3, CT (ARMCX3, ALEX3, Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3) (Biotin) discontinued
032090-Biotin 200 µL

ARMCX3, CT (ARMCX3, ALEX3, Armadillo repeat-containing X-linked protein 3, ARM protein lost in epithelial cancers on chromosome X 3) (Biotin) discontinued

Sign In for Pricing
View Details
Human P311 (Neuronal protein 3.1) ELISA Kit
EH4926 96 Tests

Human P311 (Neuronal protein 3.1) ELISA Kit

Sign In for Pricing
View Details