Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL17F protein

This Human IL17F protein spans the amino acid sequence from region 31-163aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-17F; IL-17F; Cytokine ML-1; Interleukin-24; IL-24; IL17F; IL24

Expression Region

31-163aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-17RA-Fc at 1μg/ml can bind Human IL-17F-His, the ED50 of Human IL-17F-His is 47.94 ng/ml.

Form

Lyophilized powder

Molecular Weight

15.96 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kv1.1 potassium channel Polyclonal Antibody
MBS8519743-01 0.1 mg

Kv1.1 potassium channel Polyclonal Antibody

Sign In for Pricing
View Details
Kv1.1 potassium channel Polyclonal Antibody
MBS8519743-02 0.1 mL (AF635)

Kv1.1 potassium channel Polyclonal Antibody

Sign In for Pricing
View Details
Kv1.1 potassium channel Polyclonal Antibody
MBS8519743-03 0.1 mL (AF610)

Kv1.1 potassium channel Polyclonal Antibody

Sign In for Pricing
View Details
Kv1.1 potassium channel Polyclonal Antibody
MBS8519743-04 0.1 mL (AF405S)

Kv1.1 potassium channel Polyclonal Antibody

Sign In for Pricing
View Details
Kv1.1 potassium channel Polyclonal Antibody
MBS8519743-05 0.1 mL (AF405L)

Kv1.1 potassium channel Polyclonal Antibody

Sign In for Pricing
View Details
Kv1.1 potassium channel Polyclonal Antibody
MBS8519743-06 0.1 mL (AF546)

Kv1.1 potassium channel Polyclonal Antibody

Sign In for Pricing
View Details