Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL7 protein

This Human IL7 protein spans the amino acid sequence from region 26-177aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-7; IL-7; IL7

UniProt

P13232

Expression Region

26-177aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 0.02-0.08 ng/ml.

Form

Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80���. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2

AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibrinogen Degradation Product (FDP) ELISA Kit
YP-W11593-01 48 Tests

Human Fibrinogen Degradation Product (FDP) ELISA Kit

Sign In for Pricing
View Details
Human Fibrinogen Degradation Product (FDP) ELISA Kit
YP-W11593-02 96 Tests

Human Fibrinogen Degradation Product (FDP) ELISA Kit

Sign In for Pricing
View Details
Uncharacterized protein C15orf41 (C15orf41) Human ELISA Kit
I0816 96 Tests

Uncharacterized protein C15orf41 (C15orf41) Human ELISA Kit

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Myoglobin (MYO)
MBS2142227-01 0.1 mL

FITC-Linked Monoclonal Antibody to Myoglobin (MYO)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Myoglobin (MYO)
MBS2142227-02 0.2 mL

FITC-Linked Monoclonal Antibody to Myoglobin (MYO)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Myoglobin (MYO)
MBS2142227-03 0.5 mL

FITC-Linked Monoclonal Antibody to Myoglobin (MYO)

Sign In for Pricing
View Details