Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL7 protein

This Human IL7 protein spans the amino acid sequence from region 26-177aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-7; IL-7; IL7

UniProt

P13232

Expression Region

26-177aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL) is 0.02-0.08 ng/ml.

Form

Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80���. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 250 mM NaCl, pH 7.2

AA Sequence

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ATP synthase subunit a (atpB)
orb2917385-01 20 µg

Recombinant ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant ATP synthase subunit a (atpB)
orb2917385-02 100 µg

Recombinant ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
C6orf64 3'UTR Luciferase Stable Cell Line
TU002391 1.0 mL

C6orf64 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DYLT1 Polyclonal Antibody
RA32091-01 50 µL

DYLT1 Polyclonal Antibody

Sign In for Pricing
View Details
DYLT1 Polyclonal Antibody
RA32091-02 100 µL

DYLT1 Polyclonal Antibody

Sign In for Pricing
View Details
Uterus, Rabbit
U7000-05R 25Ea

Uterus, Rabbit

Sign In for Pricing
View Details