Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL22 protein

This Human IL22 protein spans the amino acid sequence from region 34-179aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-22; IL-22; Cytokine Zcyto18; IL-10-related T-cell-derived-inducible factor; IL-TIF; IL22; ILTIF; ZCYTO18

UniProt

Q9GZX6

Expression Region

34-179aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL-22 (E. Coli) at 2μg/ml can bind Recombinant Human IL-22RA2 (C-Fc), the ED50 of Recombinant Human IL-22RA2 (C-Fc) is 34.43 ng/ml.

Form

Lyophilized powder

Molecular Weight

16.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Peroxiredoxin-5 antibody
SL22754R-01 50 µL

Rabbit Anti-Peroxiredoxin-5 antibody

Sign In for Pricing
View Details
Rabbit Anti-Peroxiredoxin-5 antibody
SL22754R-02 100 µL

Rabbit Anti-Peroxiredoxin-5 antibody

Sign In for Pricing
View Details
CD86 (Dendritic Cells Maturation Marker) (rC86/1146), Biotin conjugate, 0.1mg/mL
BNCB2083-100 1x 100 µL

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-RTKN2 Antibody Picoband® Fluoro594 Conjugated
A12576-1-Fluoro594 100 µg/Vial

Anti-RTKN2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Ziyuglycoside II 25mg
A14688-25 25 mg

Ziyuglycoside II 25mg

Sign In for Pricing
View Details
Human GLI1 (Zinc finger protein GLI1) ELISA Kit
orb2296783-01 48 Tests

Human GLI1 (Zinc finger protein GLI1) ELISA Kit

Sign In for Pricing
View Details