Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL17A protein

This Human IL17A protein spans the amino acid sequence from region 24-155aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17

UniProt

Q16552

Expression Region

24-155aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to induce IL-6 secretion by NIH‐3T3 mouse embryonic fibroblast cells is 1-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

15.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1′S,2′S) -Nicotine-1'-oxide
HY-N8723-01 1 mg

(1′S,2′S) -Nicotine-1'-oxide

Sign In for Pricing
View Details
(1′S,2′S) -Nicotine-1'-oxide
HY-N8723-02 5 mg

(1′S,2′S) -Nicotine-1'-oxide

Sign In for Pricing
View Details
(1′S,2′S) -Nicotine-1'-oxide
HY-N8723-03 10 mg

(1′S,2′S) -Nicotine-1'-oxide

Sign In for Pricing
View Details
C1orf194 shRNA Plasmid (h)
sc-88319-SH 20 µg

C1orf194 shRNA Plasmid (h)

Sign In for Pricing
View Details
CKMT2 Protein Vector (Human) (pPM-C-HA)
PV009595 500 ng

CKMT2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
1,2,3,4-Tetra-O-acetyl-β-D-glucopyranuronic acid benzyl ester
GC7263-5g 5 g

1,2,3,4-Tetra-O-acetyl-β-D-glucopyranuronic acid benzyl ester

Sign In for Pricing
View Details