Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL17A protein

This Human IL17A protein spans the amino acid sequence from region 24-155aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17

UniProt

Q16552

Expression Region

24-155aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to induce IL-6 secretion by NIH‐3T3 mouse embryonic fibroblast cells is 1-7 ng/ml.

Form

Lyophilized powder

Molecular Weight

15.26 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4

AA Sequence

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IFABP Antibody (2J742)
TMAB-07503-01 25 µL

Anti-IFABP Antibody (2J742)

Sign In for Pricing
View Details
Anti-IFABP Antibody (2J742)
TMAB-07503-02 50 μL

Anti-IFABP Antibody (2J742)

Sign In for Pricing
View Details
Anti-IFABP Antibody (2J742)
TMAB-07503-03 100 µL

Anti-IFABP Antibody (2J742)

Sign In for Pricing
View Details
PRDM1 (PR Domain Containing 1, with ZNF Domain, BLIMP1, MGC118922, MGC118923, MGC118924, MGC118925, PRDI-BF1) (HRP)
250436-HRP 100 µL

PRDM1 (PR Domain Containing 1, with ZNF Domain, BLIMP1, MGC118922, MGC118923, MGC118924, MGC118925, PRDI-BF1) (HRP)

Sign In for Pricing
View Details
Cyanoacetamide 98% For Synthesis
00904 00500 500 g

Cyanoacetamide 98% For Synthesis

Sign In for Pricing
View Details
SLC9A3R2 discontinued
394603 200 µL

SLC9A3R2 discontinued

Sign In for Pricing
View Details